ID SPCC24E4 standard; DNA; FUN; 999 BP. XX AC AL353007; XX SV AL353007.1 XX DT 19-APR-2000 (Rel. 63, Created) DT 19-APR-2000 (Rel. 63, Last updated, Version 1) XX DE S.pombe chromosome III cosmid c24E4. XX KW ade5; ade8; glycinamide ribonucleotide transformylase. XX OS Schizosaccharomyces pombe (fission yeast) OC Eukaryota; Fungi; Ascomycota; Schizosaccharomycetes; OC Schizosaccharomycetales; Schizosaccharomycetaceae; Schizosaccharomyces. XX RN [1] RP 1-999 RA Barrell B.G., Rajandream M.A., Wood V., Saunders D., Harris D.; RT ; RL Submitted (19-APR-2000) to the EMBL/GenBank/DDBJ databases. RL Schizosaccharomyces pombe chromosome I sequencing project, Sanger Centre, RL Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA E-mail: RL barrell@sanger.ac.uk XX DR GOA; Q9UUK7; Q9UUK7. DR SWISS-PROT; Q9UUK7; PUR3_SCHPO. XX CC Notes: CC Details of yeast sequencing at the Sanger Centre are available on CC the World Wide Web. CC (URL, http://www.sanger.ac.uk/Projects/S_pombe/) CC Protein coding regions (CDS) have been predicted with the help CC of computer analysis using the Genefinder program in PomBase CC (an ACEDB database) with additional predictions for the CC branch-acceptor sites supplied by the program Sp3splice. CC CAUTION: It is possible that for any individual CDS we may have CC underestimated or overestimated the number of introns/exons or CC we may not have chosen the correct splice donor/acceptor sites. CC CDS are numbered using the following system eg SPAC5H10.01c. CC SP (S. pombe), A (chromosome 1), c5H10 (cosmid name), CC .01 (first CDS), c (complementary strand). CC The more significant matches with motifs in the PROSITE CC database are also included but some of these may be fortuitous. CC The length in codons is given for each CDS. CC IMPORTANT: This sequence MAY NOT be the entire insert of CC the sequenced clone. It may be shorter because we only CC sequence overlapping sections once, or longer, because we CC arrange for a small overlap between neighbouring submissions. CC Cosmid c24E4 is overlapped at its 5' by cosmid SPCP1E11 and at CC its 3' by cosmid SPCC569. XX FH Key Location/Qualifiers FH FT source 1..999 FT /chromosome="III" FT /db_xref="taxon:4896" FT /organism="Schizosaccharomyces pombe" FT /strain="972h-" FT /clone="cosmid c24E4" FT /map="III" FT misc_feature 1..125 FT /note="nominal overlap with SPCP1E11 S. pombe chromosome 3" FT CDS 210..833 FT /db_xref="GOA:Q9UUK7" FT /db_xref="SWISS-PROT:Q9UUK7" FT /note="SPCC24E4.01, len:207; NOTE:misnamed as ade8 from S. FT cerevisiae homolog, but actually maps to the ade5 locus" FT /gene="ade5" FT /gene="ade8" FT /product="glycinamide ribonucleotide transformylase" FT /protein_id="CAB88230.1" FT /translation="MVASLVVLISGSGSNLQAIIDATLNGVLKGEAAVTHVLSNRKNAY FT GLERAAKAGIPTSLHTLLPYKKEYGPEIGRKKYDAELAEKIIKLQPSLVVCAGWMHILS FT PEVLIPLETNKIGIINLHPALPGAFNGIHAIERAFEAAQQGKITHTGAMVHWVIAAVDE FT GKPIIVQEVPILSTDSIEALEEKIHAAEHVILVQAIHQIITDNK" FT misc_feature 222..806 FT /note="Match to PF00551 formyl_transf, Formyl transferase FT Score 159.57" FT misc_feature complement(240..999) FT /note="nominal overlap with cosmid SPCC569 S. pombe FT chromosome 3" XX SQ Sequence 999 BP; 326 A; 187 C; 187 G; 299 T; 0 other; aagcaatcct taactagcag ctaataatgg atgtttagtt aattagaaat tcagctgtta 60 aaaaacttat gtatcaaagt cacagtacta aatatttata ttaacattta atataactat 120 tgatctttat gaaaaaaaaa tttttttttc aagtaagctt cttcataaca ataatcttca 180 cctgactacc accggccact tcgtacaaga tggtagcttc acttgtcgtg ttaatttcgg 240 gatcaggttc taacctccaa gcaataattg atgctacgct gaatggagtt ttaaagggag 300 aagcagctgt aacgcacgtt ttgtcaaacc gcaaaaatgc ttatggctta gaaagagccg 360 cgaaagctgg gataccaacg tctttgcata cattgttacc ctacaaaaag gaatacggac 420 ctgagatagg aagaaaaaag tatgatgctg agttggcgga aaagataatt aagcttcaac 480 catccttggt tgtctgtgct ggatggatgc acattttgtc cccagaagtg ttgattcctt 540 tagaaacaaa taaaatcgga attattaatc ttcatccagc tcttcctggc gcttttaacg 600 gtattcatgc tatcgaacgc gcgttcgaag ctgcccagca aggaaagatc actcacaccg 660 gtgctatggt acattgggtg attgcagcag tcgatgaagg aaaacctatt atcgtgcaag 720 aggttcccat tttgtcaacc gatagtattg aagcactaga agaaaaaatt cacgcagcag 780 aacatgtaat acttgtgcag gccattcacc agatcattac tgacaataaa taaatttcat 840 tttgggagta ggggatatgc cctactaatt cttaaatttt gattattaac ctgtctttac 900 ctttgcttta cgaataaaaa tgtgaagtta taggaaaccg actgaaaccg ttgtctgcaa 960 acttcattta ttaaaccctg gttcattctg taataaact 999 //