ID SPCC17A7 standard; DNA; FUN; 928 BP. XX AC AL049472; XX SV AL049472.1 XX DT 23-MAR-1999 (Rel. 59, Created) DT 07-JAN-2000 (Rel. 62, Last updated, Version 2) XX DE S.pombe chromosome III cosmid c17A7. XX KW alpha-glucan synthase; mok1. XX OS Schizosaccharomyces pombe (fission yeast) OC Eukaryota; Fungi; Ascomycota; Schizosaccharomycetes; OC Schizosaccharomycetales; Schizosaccharomycetaceae; Schizosaccharomyces. XX RN [1] RP 1-928 RA Wood V., Rajandream M.A., Barrell B.G., Saunders D., Harris D.; RT ; RL Submitted (18-MAR-1999) to the EMBL/GenBank/DDBJ databases. RL European Schizosaccharomyces genome sequencing project, Sanger Centre, The RL Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, E-mail: RL barrell@sanger.ac.uk XX DR GOA; Q9USK8; Q9USK8. DR SWISS-PROT; Q9USK8; MOK1_SCHPO. XX CC Notes: CC Details of yeast sequencing at the Sanger Centre are available on CC the World Wide Web. CC (URL, http://www.sanger.ac.uk/Projects/S_pombe/) CC During 1995 to 1996 about 66% of S. pombe chromosome 1 was sequenced CC by the Sanger Centre. The sequencing of the S. pombe genome is now CC being continued with funding from The European Commission. CC Fourteen European sequencing laboratories, including the Sanger Centre, CC are participating in the project. CC Protein coding regions (CDS) have been predicted with the help CC of computer analysis using the Genefinder program in PomBase CC (an ACEDB database) with additional predictions for the CC branch-acceptor sites supplied by the program Sp3splice. CC CAUTION: It is possible that for any individual CDS we may have CC underestimated or overestimated the number of introns/exons or CC we may not have chosen the correct splice donor/acceptor sites. CC CDS are numbered using the following system eg SPBC25H2.01c. CC SP (S. pombe), B (chromosome 2), c25H2 (cosmid name), CC .01 (first CDS), c (complementary strand). CC The more significant matches with motifs in the PROSITE CC database are also included but some of these may be fortuitous. CC The length in codons is given for each CDS. CC IMPORTANT: This sequence MAY NOT be the entire insert of CC the sequenced clone. It may be shorter because we only CC sequence overlapping sections once, or longer, because we CC arrange for a small overlap between neighbouring submissions. CC Cosmid c17A7 is overlapped at the 5' end by c338, EMBL entry CC SPCC338, accession number AL023781 and at the 3' end by c1281, CC EMBL entry SPCC1281, accession number AL035218. XX FH Key Location/Qualifiers FH FT source 1..928 FT /chromosome="III" FT /db_xref="taxon:4896" FT /organism="Schizosaccharomyces pombe" FT /strain="972h-" FT /clone="cosmid c17A7" FT /map="IIIR" FT misc_feature complement(1..163) FT /note="nominal overlap with cosmid SPCC338, EM:AL023781 S. FT pombe chromosome 3" FT CDS 1..928 FT /codon_start=1 FT /db_xref="GOA:Q9USK8" FT /db_xref="SWISS-PROT:Q9USK8" FT /label=mok1 FT /note="SPCC17A7.01," FT /partial FT /gene="mok1" FT /gene="SPCC17A7.01" FT /gene="ags1" FT /gene="SPCC338.01c" FT /gene="SPCC1281.01" FT /product="alpha-glucan synthase mok1." FT /protein_id="CAB39330.1" FT /translation="DWKIRIKIGGLGVMAQLMAQHLKHEDLVWVVPCVGDVVYPEAEEA FT SPIEVKIIDQTYTINVYHHYLDNIKYVLLDAPVFRRQTSKEPYPARMDDLGSAIFYSAW FT NQCIAEVIRRNPIDIYHINDYHGALAPCYLLPDIIPCALSLHNAEFQGLWPLRTPEEKE FT EVCAVYNISQRVCTKYVQFGNVFNLLHAAVSYIRIHQKGFGAVGVSNKYGKRSWARYPI FT FWGLKKIGKLPNPDPTDTDEIVDDKAVAITDIDPDMEKSKVEHKRLAQEWAGLEVNEKY FT DLLVFVGRWSSQKGIDLIADIAPSLLES" FT misc_feature 706..928 FT /note="nominal overlap with cosmid SPCC1281, EM:AL035218 S. FT pombe chromosome 3" XX SQ Sequence 928 BP; 245 A; 179 C; 212 G; 292 T; 0 other; gattggaaaa ttcgcatcaa aattggtgga cttggtgtta tggctcagtt aatggctcag 60 cacttgaaac atgaggacct cgtatgggta gtaccctgtg ttggtgatgt tgtctatccg 120 gaagctgaag aagcatctcc tattgaagtt aagattattg atcagaccta tacaattaat 180 gtatatcatc attatttgga taacatcaaa tatgttttat tagatgcccc tgtttttcga 240 agacagacca gcaaagaacc atatccagct cgtatggacg atcttggatc tgccatcttc 300 tattcggcat ggaaccagtg cattgctgag gttattcgtc gaaatcctat tgatatttac 360 cacattaatg actaccatgg cgcattggct ccttgttacc ttcttcccga cattatccct 420 tgtgccttat cactccacaa tgctgaattt cagggtctct ggcccttacg tacgcctgaa 480 gagaaggaag aggtgtgtgc tgtttacaat atatcacaac gtgtttgtac gaaatatgtt 540 caattcggta atgttttcaa tctgttgcat gccgccgtgt catatatccg tattcaccag 600 aaggggttcg gagcggtagg tgtttccaat aagtatggta agcgatcctg ggctcgttat 660 cctattttct ggggtcttaa gaaaattggc aagctaccaa atcctgatcc cacggatacc 720 gacgagattg tagatgacaa ggcagtggct attacagata ttgatcctga tatggaaaag 780 agcaaggttg aacacaagcg attagctcaa gaatgggctg gtttagaggt aaatgagaag 840 tatgatcttt tggtctttgt cggtcgttgg tcttctcaga aaggtattga tttgattgct 900 gatatagccc cttcgttgct tgaatcat 928 //