ID SPBC874 standard; DNA; FUN; 787 BP. XX AC AL135748; XX SV AL135748.1 XX DT 17-DEC-1999 (Rel. 62, Created) DT 02-MAY-2002 (Rel. 71, Last updated, Version 2) XX DE S.pombe chromosome II cosmid c874. XX KW ATP-dependent RNA helicase cdc28; cdc28; prp8. XX OS Schizosaccharomyces pombe (fission yeast) OC Eukaryota; Fungi; Ascomycota; Schizosaccharomycetes; OC Schizosaccharomycetales; Schizosaccharomycetaceae; Schizosaccharomyces. XX RN [1] RP 1-787 RA Skelton J., Churcher C.M., McDougall R.C., Rajandream M.A., Barrell B.G.; RT ; RL Submitted (17-DEC-1999) to the EMBL/GenBank/DDBJ databases. RL European Schizosaccharomyces genome sequencing project, Sanger Centre, The RL Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, E-mail: RL barrell@sanger.ac.uk XX DR GOA; Q10752; Q10752. DR SWISS-PROT; Q10752; CC28_SCHPO. XX CC Notes: CC Details of yeast sequencing at the Sanger Centre are available on CC the World Wide Web. CC (URL, http://www.sanger.ac.uk/Projects/S_pombe/) CC During 1995 to 1996 about 66% of S. pombe chromosome 1 was sequenced CC by the Sanger Centre. The sequencing of the S. pombe genome is now CC being continued with funding from The European Commission. CC Fourteen European sequencing laboratories, including the Sanger Centre, CC are participating in the project. CC Protein coding regions (CDS) have been predicted with the help CC of computer analysis using the Genefinder program in PomBase CC (an ACEDB database) with additional predictions for the CC branch-acceptor sites supplied by the program Sp3splice. CC CAUTION: It is possible that for any individual CDS we may have CC underestimated or overestimated the number of introns/exons or CC we may not have chosen the correct splice donor/acceptor sites. CC CDS are numbered using the following system eg SPBC25H2.01c. CC SP (S. pombe), B (chromosome 2), c25H2 (cosmid name), CC .01 (first CDS), c (complementary strand). CC The more significant matches with motifs in the PROSITE CC database are also included but some of these may be fortuitous. CC The length in codons is given for each CDS. CC IMPORTANT: This sequence MAY NOT be the entire insert of CC the sequenced clone. It may be shorter because we only CC sequence overlapping sections once, or longer, because we CC arrange for a small overlap between neighbouring submissions. CC Cosmid c874 is overlapped at the 5' end by cosmid c21B10, EMBL CC entry SPBC21B10, accession number AL121794. and at the 3' end CC by cosmid c19C2, EMBL entry SPBC19C2, accession number AL109731. XX FH Key Location/Qualifiers FH FT source 1..787 FT /chromosome="II" FT /db_xref="taxon:4896" FT /organism="Schizosaccharomyces pombe" FT /strain="972h-" FT /clone="cosmid c874" FT /map="IIR" FT misc_feature 1..101 FT /note="nominal overlap with cosmid SPBC21B10 S. pombe FT chromosome 2" FT CDS <1..>787 FT /codon_start=2 FT /db_xref="GOA:Q10752" FT /db_xref="SWISS-PROT:Q10752" FT /note="SPBC874.01, len:262" FT /gene="cdc28" FT /gene="prp8" FT /gene="SPBC874.01" FT /gene="SPBC19C2.01" FT /gene="SPBC21B10.01c" FT /product="ATP-dependent RNA helicase; no apparent S. FT cerevisiae ortholog" FT /protein_id="CAB63784.1" FT /translation="FVIDSGFVKQNMYNPRTGMESLVSVPCSRASADQRAGRAGRVGPG FT KCFRLYTRRTYNNELDMVTSPEIQRTNLTNIVLLLKSLGINNLLDFDFMDAPPPETLMR FT SLELLYALGALNNRGELTKLGRQMAEFPTDPMLSKSLIASSKYGCVEEVLSIVSMLGEA FT SSLFYRPKDKIMEADKARANFTQPGGDHLTLLHIWNEWVDTDFSYNWARENFLQYKSLC FT RARDVRDQLANLCERVEIELVTNSSESLDPIKKAITAGYF" FT misc_feature 686..787 FT /note="nominal overlap with cosmid SPBC19C2 S. pombe FT chromosome 2" XX SQ Sequence 787 BP; 220 A; 142 C; 170 G; 255 T; 0 other; ttttgtgatt gattctggat ttgtcaaaca aaacatgtat aatccaagga ctggtatgga 60 aagcttagta tctgtgcctt gctcccgtgc ttctgctgat cagcgtgccg gccgtgctgg 120 tcgagtagga cctggaaagt gcttccgttt atatacgcgt cggacatata acaatgaact 180 ggatatggta acatctcctg aaattcaaag aacaaatttg acaaatattg ttctcttgct 240 taaatcccta ggaattaata atcttttaga tttcgacttc atggatgctc caccacctga 300 aacgttgatg cgttcattag agttattgta tgcgcttggt gccttaaaca atagaggaga 360 attgactaag ctcggcaggc agatggcaga gtttcctaca gatcctatgc tttctaaatc 420 tttgattgca tcttcaaagt atggatgtgt tgaagaagtg ttatcaattg tttctatgtt 480 aggggaggct tcctctttat tctatagacc aaaagacaaa ataatggaag cggataaagc 540 tagagcgaac tttacccaac ctggtggtga tcatttaact cttcttcata tttggaatga 600 atgggtagat actgactttt cgtacaattg ggcccgtgaa aactttttac agtataagag 660 tttatgtcga gctcgagatg ttcgtgatca acttgccaat ctctgtgaac gggtggaaat 720 tgaattggta actaattctt cagagtccct tgatcctatt aagaaagcta tcacagctgg 780 ttatttt 787 //