ID   SPBC29C10  standard; DNA; FUN; 787 BP.
XX
AC   AL358273;
XX
SV   AL358273.1
XX
DT   06-JUN-2000 (Rel. 64, Created)
DT   06-JUN-2000 (Rel. 64, Last updated, Version 1)
XX
DE   S.pombe chromosome II cosmid c29C10.
XX
KW   60s ribosomal protien L37; rpl37.
XX
OS   Schizosaccharomyces pombe (fission yeast)
OC   Eukaryota; Fungi; Ascomycota; Schizosaccharomycetes;
OC   Schizosaccharomycetales; Schizosaccharomycetaceae; Schizosaccharomyces.
XX
RN   [1]
RP   1-787
RA   Lyne M., Rajandream M.A., Barrell B.G., Saunders D., Harris D.;
RT   ;
RL   Submitted (05-JUN-2000) to the EMBL/GenBank/DDBJ databases.
RL   European Schizosaccharomyces genome sequencing project, Sanger Centre, The
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, E-mail:
RL   barrell@sanger.ac.uk
XX
DR   GOA; Q9USX4; Q9USX4.
DR   SWISS-PROT; Q9USX4; R33A_SCHPO.
XX
CC   Notes:
CC   Details of yeast sequencing at the Sanger Centre are available on
CC   the World Wide Web.
CC   (URL, http://www.sanger.ac.uk/Projects/S_pombe/)
CC   During 1995 to 1996 about 66% of S. pombe chromosome 1 was sequenced
CC   by the Sanger Centre.  The sequencing of the S. pombe genome is now
CC   being continued with funding from The European Commission.
CC   Fourteen European sequencing laboratories, including the Sanger Centre,
CC   are participating in the project.
CC   Protein coding regions (CDS) have been predicted with the help
CC   of computer analysis using the Genefinder program in PomBase
CC   (an ACEDB database) with additional predictions for the
CC   branch-acceptor sites supplied by the program Sp3splice.
CC   CAUTION: It is possible that for any individual CDS we may have
CC   underestimated or overestimated the number of introns/exons or
CC   we may not have chosen the correct splice donor/acceptor sites.
CC   CDS are numbered using the following system eg SPBC25H2.01c.
CC   SP (S. pombe), B (chromosome 2), c25H2 (cosmid name),
CC   .01 (first CDS), c (complementary strand).
CC   The more significant matches with motifs in the PROSITE
CC   database are also included but some of these may be fortuitous.
CC   The length in codons is given for each CDS.
CC   IMPORTANT: This sequence MAY NOT be the entire insert of
CC   the sequenced clone.  It may be shorter because we only
CC   sequence overlapping sections once, or longer, because we
CC   arrange for a small overlap between neighbouring submissions.
CC   Cosmid c29C10 is overlapped at the 3' end by cosmid c1921,
CC   EMBL entry SPBC1921, accession number AL122033.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /chromosome="II"
FT                   /db_xref="taxon:4896"
FT                   /organism="Schizosaccharomyces pombe"
FT                   /strain="972h-"
FT                   /clone="cosmid c29C10"
FT                   /map="IIR"
FT   CDS             join(complement(666..787),complement(417..534))
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9USX4"
FT                   /db_xref="SWISS-PROT:Q9USX4"
FT                   /label=rpl37-1
FT                   /note="SPBC29C10.01c, len:79,
FT                   SIMILARITY:Schizosaccharomyces pombe, O74647, ribosomal
FT                   protein l37 homolog, (107 aa), fasta scores: opt: 481,
FT                   E():4.1e-32, (84.8% identity in 79 aa)"
FT                   /partial
FT                   /gene="rpl37-1"
FT                   /gene="SPBC1921.01c"
FT                   /gene="SPBC29C10.01c"
FT                   /product="60s ribosomal protein l37"
FT                   /protein_id="CAB93850.1"
FT                   /translation="MVKIEGCDSKEEAQFYLGKRICFVYKSNKPVRGSKIRVIWGTVSR
FT                   PHGNSGVVRARFTHNLPPKTFGASLRVMLYPSNV"
FT   misc_feature    join(complement(666..784),complement(438..534))
FT                   /note="Match to PF01247 Ribosomal_L35Ae, Ribosomal protein
FT                   L35Ae Score 105.44"
FT   misc_feature    complement(535..549)
FT                   /note="ctaattacgttttag, splice branch and acceptor"
FT   intron          complement(535..665)
FT                   /note="confirmed intron"
FT   misc_feature    complement(660..665)
FT                   /note="gtaagt, splice donor sequence"
FT   misc_feature    687..787
FT                   /note="nominal overlap with cosmid SPBC1921 AL122033
FT                   S.pombe chromosome II"
XX
SQ   Sequence 787 BP; 297 A; 141 C; 133 G; 216 T; 0 other;
     gatcgacagc cgattataaa catgctcgac agtattcgat cgaactacct gcataaacaa        60
     ggtagtattc agtactaaag gttagacgcc aaactagtga atttacaata cctaagtaat       120
     tgatgcagtg ttgcccatca acaccctaag aacagacgac tgaaatgata cttcgtgaaa       180
     cgattctcaa aagttaccta tacaaattta cagcttttgt tatttaacat caatattgat       240
     taaacttaaa ttaataattg tgttttaatg taccaattac aaattcctag tgagtaaata       300
     ataccaaaag cattgattac tttgtataac aaacgaggct ttcgataaaa tgggattccc       360
     taaataaaat aaatctaaga agcagaagaa ttgttgtgaa cataaaaata ttttatttaa       420
     acattggagg gataaagcat gacacggaga gaggcaccaa aggtcttggg aggaagatta       480
     tgggtgaaac gagcacgaac aacaccagaa tttccatgag gacgactaac agttctaaaa       540
     cgtaattagt aaaggttttg aatgtattcg tttagccaac aaaaaacgac cgtgaaaata       600
     tagcattaac gtttcttcat attctccaaa gaaacgcaag aatttaatta caaaaataaa       660
     cttaccccca aatgacacga atcttggatc cacgaacggg cttgttgctt ttgtagacga       720
     agcaaatacg cttgcctagg taaaattggg cttcttcctt agaatcacat ccctcaatct       780
     ttaccaa                                                                 787
//