ID   SPAPYUL23  standard; DNA; FUN; 530 BP.
XX
AC   AL096845;
XX
SV   AL096845.1
XX
DT   16-JUL-1999 (Rel. 60, Created)
DT   16-JUL-1999 (Rel. 60, Last updated, Version 1)
XX
DE   S.pombe chromosome I plasmid pYUL23.
XX
KW   dna-directed rna polymerase i and iii 14 kDa polypeptide.
XX
OS   Schizosaccharomyces pombe (fission yeast)
OC   Eukaryota; Fungi; Ascomycota; Schizosaccharomycetes;
OC   Schizosaccharomycetales; Schizosaccharomycetaceae; Schizosaccharomyces.
XX
RN   [1]
RP   1-530
RA   Harris D., Lyne M.H., Rajandream M.A., Barrell B.G.;
RT   ;
RL   Submitted (16-JUL-1999) to the EMBL/GenBank/DDBJ databases.
RL   European Schizosaccharomyces genome sequencing project, Sanger Centre, The
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, E-mail:
RL   barrell@sanger.ac.uk
XX
DR   GOA; Q09177; Q09177.
DR   SWISS-PROT; Q09177; RPC9_SCHPO.
XX
CC   Notes:
CC   Details of yeast sequencing at the Sanger Centre are available on
CC   the World Wide Web.
CC   (URL, http://www.sanger.ac.uk/Projects/S_pombe/)
CC   During 1995 to 1996 about 66% of S. pombe chromosome 1 was sequenced
CC   by the Sanger Centre.  The sequencing of the S. pombe genome is now
CC   being continued with funding from The European Commission.
CC   Fourteen European sequencing laboratories, including the Sanger Centre,
CC   are participating in the project.
CC   Protein coding regions (CDS) have been predicted with the help
CC   of computer analysis using the Genefinder program in PomBase
CC   (an ACEDB database) with additional predictions for the
CC   branch-acceptor sites supplied by the program Sp3splice.
CC   CAUTION: It is possible that for any individual CDS we may have
CC   underestimated or overestimated the number of introns/exons or
CC   we may not have chosen the correct splice donor/acceptor sites.
CC   CDS are numbered using the following system eg SPBC25H2.01c.
CC   SP (S. pombe), B (chromosome 2), c25H2 (cosmid name),
CC   .01 (first CDS), c (complementary strand).
CC   The more significant matches with motifs in the PROSITE
CC   database are also included but some of these may be fortuitous.
CC   The length in codons is given for each CDS.
CC   IMPORTANT: This sequence MAY NOT be the entire insert of
CC   the sequenced clone.  It may be shorter because we only
CC   sequence overlapping sections once, or longer, because we
CC   arrange for a small overlap between neighbouring submissions.
CC   Cosmid pYUL23 is overlapped at the 5' end by cosmid c22H12,
CC   EMBL entry SPAC22H12, accession number AL034565 and at the 3'
CC   end by cosmid c1687, EMBL entry SPAC1687, accession number AL035064.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..530
FT                   /chromosome="I"
FT                   /db_xref="taxon:4896"
FT                   /organism="Schizosaccharomyces pombe"
FT                   /strain="972h-"
FT                   /clone="cosmid pYUL23"
FT                   /map="IL"
FT   misc_feature    1..107
FT                   /note="nominal overlap with cosmid SPAC22H12 S. pombe
FT                   chromosome 1"
FT   CDS             join(270..341,415..512)
FT                   /db_xref="GOA:Q09177"
FT                   /db_xref="SWISS-PROT:Q09177"
FT                   /label=rpc19 or rpa17
FT                   /note="SPAPYUL23.01, len:55"
FT                   /partial
FT                   /gene="rpc19"
FT                   /gene="rpa17"
FT                   /gene="SPAPYUL23.01"
FT                   /product="dna-directed rna polymerase i and iii 14 kda
FT                   polypeptide"
FT                   /protein_id="CAB50921.1"
FT                   /translation="MAAMTDVTDPSSVAMESATEKIIILPGHSADLTSVTFQIQKEDHT
FT                   LGNSLRYVIMK"
FT   misc_feature    342..347
FT                   /note="gtatgt, splice donor sequence"
FT   intron          342..414
FT                   /note="Confirmed Intron by EST data"
FT   misc_feature    399..414
FT                   /note="ctaactaaagttatag, splice branch and acceptor"
FT   misc_feature    418..513
FT                   /note="Match to PF01193 RNA_pol_L, RNA polymerases L / 13
FT                   to 16 kDa subunit Score 34.91"
FT   misc_feature    433..530
FT                   /note="nominal overlap with cosmid SPAC1687 S. pombe
FT                   chromosome 1"
XX
SQ   Sequence 530 BP; 172 A; 93 C; 82 G; 183 T; 0 other;
     caaacactga taaaatactt taaaattgaa actcattgac tcgtcaacaa aatcttgtat        60
     tttttacctg tcaacgattt aacgcagcct cttgttgctt caggatcata cgctaaaatc       120
     tctgcaaaaa tatgcgttaa cctacactaa atacggattc ttcctttgga aattgagcag       180
     cgttagaaaa tttgtaaaga gccaaatatt gctgtttgca tagaagtttc gctgtatctt       240
     ttcttttttt tataaaataa actttagaca tggcggcaat gacagacgta acagatccta       300
     gctcagttgc tatggaatct gcaactgaaa aaataattat cgtatgtgtt tggcataagg       360
     atttgatttt ctttagcatt gttccttcaa ttaatatgct aactaaagtt atagcttcct       420
     ggtcattctg ctgatcttac atctgtgaca tttcaaattc aaaaagagga ccatacgcta       480
     ggcaattctc ttcgctatgt cattatgaaa aagtaaattg atattaaatt                  530
//